PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000179225
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 1020aa    MW: 111833 Da    PI: 5.0435
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000179225genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding58.51.5e-183783148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+l +av+++ g++Wk+Ia+++   Rt+ qc +rwqk+l
    MDP0000179225 37 KGQWTPEEDEILRRAVQRFKGKNWKKIAECFK-DRTDVQCLHRWQKVL 83
                     799****************************9.************986 PP

2Myb_DNA-binding62.86.7e-2089135148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      +g+W++eEd+ ++++vk++G++ W+tIa++++ gR +kqc++rw+++l
    MDP0000179225  89 KGPWSKEEDDVIIELVKKYGPKKWSTIAQHLP-GRIGKQCRERWHNHL 135
                      79******************************.*************97 PP

3Myb_DNA-binding48.81.6e-15141183145
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                      + +WT+eE++ l++a++++G++ W+   + ++ gRt++ +k++w+
    MDP0000179225 141 KEAWTQEEELALIRAHQMYGNK-WAELTKFLP-GRTDNAIKNHWN 183
                      579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129418.1773283IPR017930Myb domain
SuperFamilySSF466894.09E-193598IPR009057Homeodomain-like
SMARTSM007171.2E-153685IPR001005SANT/Myb domain
PfamPF002492.7E-163783IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.2E-223895IPR009057Homeodomain-like
CDDcd001672.06E-144083No hitNo description
PROSITE profilePS5129433.784139IPR017930Myb domain
SuperFamilySSF466891.12E-3186182IPR009057Homeodomain-like
SMARTSM007177.1E-1988137IPR001005SANT/Myb domain
PfamPF002492.4E-1889135IPR001005SANT/Myb domain
CDDcd001671.29E-1691135No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2796143IPR009057Homeodomain-like
SMARTSM007175.7E-15140188IPR001005SANT/Myb domain
PROSITE profilePS5129419.738140190IPR017930Myb domain
PfamPF002497.2E-14141184IPR001005SANT/Myb domain
CDDcd001671.54E-11143183No hitNo description
Gene3DG3DSA:1.10.10.601.2E-21144190IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
Sequence ? help Back to Top
Protein Sequence    Length: 1020 aa     Download sequence    Send to blast
MEGERTNSTP SEVLGDNNQK ARALHGRTSG PTRRSTKGQW TPEEDEILRR AVQRFKGKNW  60
KKIAECFKDR TDVQCLHRWQ KVLNPELVKG PWSKEEDDVI IELVKKYGPK KWSTIAQHLP  120
GRIGKQCRER WHNHLNPGIN KEAWTQEEEL ALIRAHQMYG NKWAELTKFL PGRTDNAIKN  180
HWNSSVKKKL DSYLKSGLLT QFQGMPHVGN QSQHMMSSSS RMQSSGDDSG AKGAEAEEIS  240
ECSQDSTVAG RSAQMANVVP HPIEEFQNNE VSHLANDPSF SPVSCSEPYY PSIGXANVSI  300
PEIPPELVCS KYLEQNFSHD AGASMSGDFQ LNLHELPNIS SLECGQESLR MHGGVEAPFQ  360
TSTSMGNMAV GSVKSEHMLI SDDECCRVLF SMNDGCFPSR XFTDDSNMVD LGACTDSVLL  420
QPSNLQISDP GRTSASQLYH PLNSGVIGTS CSQVVSAHET PLIYAGEPTH LFIVQDQEFV  480
TSSNDGFIYT NESASSPCKS DLVSDSSKLV PVNTFALGLD AQTCPVDVSS NEQTEQQDAG  540
SLCYEPPRFP SLDIPFFSCD LIQSGNDMQQ EYSPLGIRQL MMSSMNCLTP YRLWDSPSXE  600
GSPDALLKSA AKTFTGTPSI LKKRHRDLLS PLSPLSDRRF DKRVGTDVTS CLARDFSRLD  660
VMFEDTENKE DSLSPSSDQK RNSDASVEDK ENKGTCENKV EKGIDSTAMS DDGTAQKDVD  720
DGQSQEKRKQ FQQTSDVDAE SKVDLVPTTQ SAQPSGVLVE RNTNDLLLNS PDVVGCKAEK  780
PFGSTARTPK XLLRKSFEAT NPGVPSKSFS ARQCSSVKTP TICIKKHESL ADKCLQSGSS  840
SVPPETSGDN AGNDVSIESM FGGTPFKRSI ESPSAWKSPW FINSFVPGPS VDTEITIEDI  900
GFFMSPGDRS YDAIGLMKQI SEQSAAAYAN AQEVLGNETP ESLFQERQKD RDXAGLENKQ  960
GLPNQPGSAS LSGSDVXVER RTLDFSECGT PGKKGTENVK SASNAKSFSS PTSYLLKGCR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C4e-70371906159MYB PROTO-ONCOGENE PROTEIN
1h89_C4e-70371906159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.85530.0fruit
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00466DAPTransfer from AT4G32730Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008378105.10.0PREDICTED: myb-related protein 3R-1
SwissprotQ9S7G70.0MB3R1_ARATH; Myb-related protein 3R-1
TrEMBLM5XM690.0M5XM69_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s25840.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF37273362
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G32730.20.0Homeodomain-like protein